| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Appetite-regulating hormone |
|---|
| Ligand | BDBM50359233 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_790253 (CHEMBL1925646) |
|---|
| Ki | 6.2±n/a nM |
|---|
| Citation |  Hoveyda, HR; Marsault, E; Gagnon, R; Mathieu, AP; Vézina, M; Landry, A; Wang, Z; Benakli, K; Beaubien, S; Saint-Louis, C; Brassard, M; Pinault, JF; Ouellet, L; Bhat, S; Ramaseshan, M; Peng, X; Foucher, L; Beauchemin, S; Bhérer, P; Veber, DF; Peterson, ML; Fraser, GL Optimization of the potency and pharmacokinetic properties of a macrocyclic ghrelin receptor agonist (Part I): Development of ulimorelin (TZP-101) from hit to clinic. J Med Chem54:8305-20 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Appetite-regulating hormone |
|---|
| Name: | Appetite-regulating hormone |
|---|
| Synonyms: | GHRL | GHRL_HUMAN | Ghrelin | Ghrelin-27 | Ghrelin-28 | Growth hormone secretagogue | Growth hormone-releasing peptide | MTLRP | Motilin-related peptide | Obestatin | Protein M46 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12908.57 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_790253 |
|---|
| Residue: | 117 |
|---|
| Sequence: | MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPE
DGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
|
|
|
|---|
| BDBM50359233 |
|---|
| n/a |
|---|
| Name | BDBM50359233 |
|---|
| Synonyms: | CHEMBL1923623 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H37FN4O4 |
|---|
| Mol. Mass. | 524.6269 |
|---|
| SMILES | C[C@H]1N(C)C(=O)[C@@H](NCCOc2ccccc2CCCNC(=O)[C@@H](Cc2ccccc2F)NC1=O)C1CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
