Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettrace amine-associated receptor 1
LigandBDBM10758
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792743
EC50 106±n/a nM
Citation Lewin AHMiller GMGilmour B Trace amine-associated receptor 1 is a stereoselective binding site for compounds in the amphetamine class. Bioorg Med Chem 19:7044-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
trace amine-associated receptor 1
Name:Trace amine-associated receptor 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39107.47
Organism:Homo sapiens (Human)
Description:ChEMBL_792734
Residue:339
Sequence:
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10758
n/a
NameBDBM10758
Synonyms:14C-phenylethylamine | 2-phenylethan-1-amine | CHEMBL610 | phenylethylamine
TypeSmall organic molecule
Emp. Form.C8H11N
Mol. Mass.121.1796
SMILESNCCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: