Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThymidylate kinase
LigandBDBM50359625
Substrate/Competitorn/a
Meas. Tech.ChEMBL_793312
Ki 170±n/a nM
Citation Van Poecke SMunier-Lehmann HHelynck OFroeyen MVan Calenbergh S Synthesis and inhibitory activity of thymidine analogues targeting Mycobacterium tuberculosis thymidine monophosphate kinase. Bioorg Med Chem 19:7603-11 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thymidylate kinase
Name:Thymidylate kinase
Synonyms:TMPK | Thymidine monophosphate kinase | dTMP kinase
Type:PROTEIN
Mol. Mass.:22636.29
Organism:Mycobacterium tuberculosis
Description:ChEMBL_208218
Residue:214
Sequence:
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLA
SSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWV
QRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYA
ELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50359625
n/a
NameBDBM50359625
Synonyms:CHEMBL1928435
TypeSmall organic molecule
Emp. Form.C18H18ClF3N4O3S2
Mol. Mass.494.939
SMILESCc1cn([C@@H]2C[C@H](O)[C@@H](CNC(=S)Nc3ccc(Cl)c(c3)C(F)(F)F)O2)c(=O)[nH]c1=S |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: