Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II alpha
LigandBDBM50156673
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792096
Ki 106±n/a nM
Citation Janeczko MOrzeszko AKazimierczuk ZSzyszka RBaier A CK2a and CK2a' subunits differ in their sensitivity to 4,5,6,7-tetrabromo- and 4,5,6,7-tetraiodo-1H-benzimidazole derivatives. Eur J Med Chem 47:345-50 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II alpha
Name:Casein kinase II alpha
Synonyms:CK II | CK2 | CK2- alpha | CK2A1 | CSNK2A1 | Casein kinase II (CK2) | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a) | Casein kinase II subunit alpha (CK2α)
Type:Enzyme
Mol. Mass.:45151.12
Organism:Homo sapiens (Human)
Description:P68400
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156673
n/a
NameBDBM50156673
Synonyms:((4,5,6,7-tetrabromo-1H-benzimidazol-2-yl)sulfanyl)-acetic acid | 2-(4,5,6,7-tetrabromo-1H-benzo[d]imidazol-2-ylthio)acetic acid | CHEMBL223082
TypeSmall organic molecule
Emp. Form.C9H4Br4N2O2S
Mol. Mass.523.821
SMILESOC(=O)CSc1nc2c(Br)c(Br)c(Br)c(Br)c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: