Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase II subunit alpha
LigandBDBM50359840
Substrate/Competitorn/a
Meas. Tech.ChEMBL_792165
Ki 31±n/a nM
Citation Janeczko MOrzeszko AKazimierczuk ZSzyszka RBaier A CK2a and CK2a' subunits differ in their sensitivity to 4,5,6,7-tetrabromo- and 4,5,6,7-tetraiodo-1H-benzimidazole derivatives. Eur J Med Chem 47:345-50 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein kinase II subunit alpha
Name:Casein kinase II subunit alpha
Synonyms:CSNK2A2 | Casein kinase II alpha (prime) | Casein kinase II subunit alpha (CK2A2) | Casein kinase II subunit alpha (CSNK2A2)
Type:Protein
Mol. Mass.:41223.82
Organism:Homo sapiens (Human)
Description:n/a
Residue:350
Sequence:
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINI
TNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNT
DFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLA
EFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNY
DQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALD
LLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50359840
n/a
NameBDBM50359840
Synonyms:CHEMBL1928903
TypeSmall organic molecule
Emp. Form.C10H6Br4N2O2S
Mol. Mass.537.848
SMILESOC(=O)CCSc1nc2c(Br)c(Br)c(Br)c(Br)c2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: