Reaction Details |
| Report a problem with these data |
Target | Hypoxanthine-guanine phosphoribosyltransferase |
---|
Ligand | BDBM50360108 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_793806 (CHEMBL1932721) |
---|
Ki | >100000±n/a nM |
---|
Citation | Cesnek, M; Hocková, D; Holý, A; Dracínský, M; Baszczynski, O; Jersey, Jd; Keough, DT; Guddat, LW Synthesis of 9-phosphonoalkyl and 9-phosphonoalkoxyalkyl purines: evaluation of their ability to act as inhibitors of Plasmodium falciparum, Plasmodium vivax and human hypoxanthine-guanine-(xanthine) phosphoribosyltransferases. Bioorg Med Chem20:1076-89 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hypoxanthine-guanine phosphoribosyltransferase |
---|
Name: | Hypoxanthine-guanine phosphoribosyltransferase |
Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
Type: | Protein |
Mol. Mass.: | 24579.61 |
Organism: | Homo sapiens (Human) |
Description: | P00492 |
Residue: | 218 |
Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
BDBM50360108 |
---|
n/a |
---|
Name | BDBM50360108 |
Synonyms: | CHEMBL1928775 |
Type | Small organic molecule |
Emp. Form. | C7H10N5O4P |
Mol. Mass. | 259.1592 |
SMILES | Nc1nc2n(CCP(O)(O)=O)cnc2c(=O)[nH]1 |
Structure |
|