| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM50049966 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_793806 (CHEMBL1932721) |
|---|
| Ki | 400±n/a nM |
|---|
| Citation |  Cesnek, M; Hocková, D; Holý, A; Dracínský, M; Baszczynski, O; Jersey, Jd; Keough, DT; Guddat, LW Synthesis of 9-phosphonoalkyl and 9-phosphonoalkoxyalkyl purines: evaluation of their ability to act as inhibitors of Plasmodium falciparum, Plasmodium vivax and human hypoxanthine-guanine-(xanthine) phosphoribosyltransferases. Bioorg Med Chem20:1076-89 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM50049966 |
|---|
| n/a |
|---|
| Name | BDBM50049966 |
|---|
| Synonyms: | CHEMBL177948 | [4-(2-Amino-6-oxo-1,6-dihydro-purin-9-ylmethoxy)-butyl]-phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H16N5O5P |
|---|
| Mol. Mass. | 317.2383 |
|---|
| SMILES | Nc1nc2n(COCCCCP(O)(O)=O)cnc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
