Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50360416
Substrate/Competitorn/a
Meas. Tech.ChEMBL_796433
Ki 4±n/a nM
Citation Bryan MCBiswas KPeterkin TARzasa RMArik LLehto SGSun HHsieh FYXu CFremeau RTAllen JR Chromenones as potent bradykinin B1 antagonists. Bioorg Med Chem Lett 22:619-22 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360416
n/a
NameBDBM50360416
Synonyms:CHEMBL1934260
TypeSmall organic molecule
Emp. Form.C32H31ClN2O3
Mol. Mass.527.053
SMILESClc1cccc2occ(-c3ccc(cc3)C(=O)N[C@H]3CCCc4cc(CN5CCCCC5)ccc34)c(=O)c12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: