| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 2 |
|---|
| Ligand | BDBM23165 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_796730 (CHEMBL1938045) |
|---|
| IC50 | 5.9±n/a nM |
|---|
| Citation |  He, X; Wang, L; Zheng, Z; Xiao, J; Zhong, W; Li, S Novel immunomodulators based on an oxazolin-2-one-4-carboxamide scaffold. Bioorg Med Chem Lett22:553-7 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 2 |
|---|
| Name: | Sphingosine 1-phosphate receptor 2 |
|---|
| Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38883.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
|---|
| Residue: | 353 |
|---|
| Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
|---|
| BDBM23165 |
|---|
| n/a |
|---|
| Name | BDBM23165 |
|---|
| Synonyms: | CHEMBL366208 | FTY720-phosphate, (S)-2 | [(2S)-2-amino-3-hydroxy-2-[2-(4-octylphenyl)ethyl]propoxy]phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H34NO5P |
|---|
| Mol. Mass. | 387.4507 |
|---|
| SMILES | CCCCCCCCc1ccc(CC[C@](N)(CO)COP(O)(O)=O)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
