Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase CHK2
LigandBDBM50360609
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795641
IC50>30000±n/a nM
Citation Powell NAKohrt JTFilipski KJKaufman MSheehan DEdmunds JEDelaney AWang YBourbonais FLee DYSchwende FSun FMcConnell PCatana CChen HOhren JPerrin LA Novel and selective spiroindoline-based inhibitors of Sky kinase. Bioorg Med Chem Lett 22:190-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase CHK2
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:Cds1
Type:Protein
Mol. Mass.:60908.59
Organism:Homo sapiens (Human)
Description:O96017
Residue:543
Sequence:
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360609
n/a
NameBDBM50360609
Synonyms:CHEMBL1933551
TypeSmall organic molecule
Emp. Form.C26H30N4O
Mol. Mass.414.5426
SMILESC[C@@H]1CCC(CN1)N1CC[C@@]2(C1)CN(C(=O)c1cc3ccccc3[nH]1)c1ccccc21 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: