Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase TAO3
LigandBDBM50360610
Substrate/Competitorn/a
Meas. Tech.ChEMBL_795564
IC50>30000±n/a nM
Citation Powell NAKohrt JTFilipski KJKaufman MSheehan DEdmunds JEDelaney AWang YBourbonais FLee DYSchwende FSun FMcConnell PCatana CChen HOhren JPerrin LA Novel and selective spiroindoline-based inhibitors of Sky kinase. Bioorg Med Chem Lett 22:190-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase TAO3
Name:Serine/threonine-protein kinase TAO3
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:105420.26
Organism:Homo sapiens (Human)
Description:ChEMBL_774581
Residue:898
Sequence:
MRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFATNAHTSEVVAIKKMSYSGK
QTHEKWQDILKEVKFLRQLKHPNTIEYKGCYLKEHTAWLVMEYCLGSASDLLEVHKKPLQ
EVEIAAITHGALHGLAYLHSHALIHRDIKAGNILLTEPGQVKLADFGSASMASPANSFVG
TPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQNDSPT
LQSNEWTDSFRRFVDYCLQKIPQERPTSAELLRHDFVRRDRPLRVLIDLIQRTKDAVREL
DNLQYRKMKKILFQETRNGPLNESQEDEEDSEHGTSLNREMDSLGSNHSIPSMSVSTGSQ
SSSVNSMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQ
SVQSQALHYRNRERFATIKSASLVTRQIHEHEQENELREQMSGYKRMRRQHQKQLIALEN
KLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKEAKVAAADEKKFQQQILAQ
QKKDLTTFLESQKKQYKICKEKIKEEMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHL
LTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIREELNKKRTQKEMEHAMLIRHDESTRELE
YRQLHTLQKLRMDLIRLQHQTELENQLEYNKRRERELHRKHVMELRQQPKNLKAMEMQIK
KQFQDTCKVQTKQYKALKNHQLEVTPKNEHKTILKTLKDEQTRKLAILAEQYEQSINEMM
ASQALRLDEAQEAECQALRLQLQQEMELLNAYQSKIKMQTEAQHERELQKLEQRVSLRRA
HLEQKIEEELAALQKERSERIKNLLERQEREIETFDMESLRMGFGNLVTLDFPKEDYR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50360610
n/a
NameBDBM50360610
Synonyms:CHEMBL1933552
TypeSmall organic molecule
Emp. Form.C26H29FN4O
Mol. Mass.432.5331
SMILESC[C@@H]1CCC(CN1)N1CC[C@@]2(C1)CN(C(=O)c1cc3ccc(F)cc3[nH]1)c1ccccc21 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: