Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H4 Receptor
LigandBDBM50361012
Substrate/Competitorn/a
Meas. Tech.ChEMBL_796037
Ki 23±n/a nM
Citation Smits RALim HDvan der Meer TKuhne SBessembinder KZuiderveld OPWijtmans Mde Esch IJLeurs R Ligand based design of novel histamine H4 receptor antagonists; fragment optimization and analysis of binding kinetics. Bioorg Med Chem Lett 22:461-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H4 Receptor
Name:Histamine H4 Receptor
Synonyms:HH4R
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44272.75
Organism:Mus musculus (mouse)
Description:Cell pellets from SK-N-MC cells transfected with mouse H4 receptor were used in binding assay.
Residue:391
Sequence:
MSESNSTGILPPAAQVPLAFLMSSFAFAIMVGNAVVILAFVVDRNLRHRSNYFFLNLAIS
DFLVGLISIPLYIPHVLFNWNFGSGICMFWLITDYLLCTASVYNIVLISYDRYQSVSNAV
SYRAQHTGIMKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTKDCEPGFVTEWYILTIT
MLLEFLLPVISVAYFNVQIYWSLWKRRALSRCPSHAGFSTTSSSASGHLHRAGVACRTSN
PGLKESAASRHSESPRRKSSILVSLRTHMNSSITAFKVGSFWRSESAALRQREYAELLRG
RKLARSLAILLSAFAICWAPYCLFTIVLSTYPRTERPKSVWYSIAFWLQWFNSFVNPFLY
PLCHRRFQKAFWKILCVTKQPALSQNQSVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361012
n/a
NameBDBM50361012
Synonyms:CHEMBL1935574
TypeSmall organic molecule
Emp. Form.C16H17N5O
Mol. Mass.295.3391
SMILESNc1nc(N2CCNCC2)c2ccc(cc2n1)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: