Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM22914 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_795794 (CHEMBL1936681) |
---|
IC50 | 977±n/a nM |
---|
Citation | Smits, RA; Lim, HD; van der Meer, T; Kuhne, S; Bessembinder, K; Zuiderveld, OP; Wijtmans, M; de Esch, IJ; Leurs, R Ligand based design of novel histamine H4 receptor antagonists; fragment optimization and analysis of binding kinetics. Bioorg Med Chem Lett22:461-7 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | AXOR35 | G-protein coupled receptor 105 | GPCR105 | GPRv53 | HH4R | HISTAMINE H4 | HRH4 | HRH4_HUMAN | Histamine H4 receptor | Histamine H4 receptor (H4R) | Histamine receptor (H3 and H4) | Pfi-013 | SP9144 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44517.02 |
Organism: | Homo sapiens (Human) |
Description: | Binding assays were using CHO cells stably expressing hH4R receptors. |
Residue: | 390 |
Sequence: | MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV
SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF
LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA
STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR
LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL
CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS
|
|
|
BDBM22914 |
---|
n/a |
---|
Name | BDBM22914 |
Synonyms: | CHEMBL260374 | N-cyclohexyl-4-(1H-imidazol-5-yl)piperidine-1-carbothioamide | Thioperamide | US11622967, Compound Thioperamide |
Type | Small organic molecule |
Emp. Form. | C15H24N4S |
Mol. Mass. | 292.443 |
SMILES | S=C(NC1CCCCC1)N1CCC(CC1)c1cnc[nH]1 |
Structure |
|