Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMisshapen-like kinase 1
LigandBDBM50361467
Substrate/Competitorn/a
Meas. Tech.ChEMBL_797145
IC50 6±n/a nM
Citation Millan DSBunnage MEBurrows JLButcher KJDodd PGEvans TJFairman DAHughes SJKilty ICLemaitre ALewthwaite RAMahnke AMathias JPPhilip JSmith RTStefaniak MHYeadon MPhillips C Design and synthesis of inhaled p38 inhibitors for the treatment of chronic obstructive pulmonary disease. J Med Chem 54:7797-814 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Misshapen-like kinase 1
Name:Voltage-gated potassium channel subunit Kv7.1/Misshapen-like kinase 1
Synonyms:GCK family kinase MiNK | MAPK/ERK kinase kinase kinase 6 | MEK kinase kinase 6 | MEKKK 6 | Misshapen/NIK-related kinase | Mitogen-activated protein kinase kinase kinase kinase 6
Type:PROTEIN
Mol. Mass.:149838.92
Organism:Homo sapiens (Human)
Description:ChEMBL_793919
Residue:1332
Sequence:
MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNT
KGNALKEDCIAYICREILRGLAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPTEQLLKFPFIRDQPTERQVRI
QLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGESTLRREFLRLQQ
ENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQ
QQQQQQQLQKQQQQQLLPGDRKPLYHYGRGMNPADKPAWAREVEERTRMNKQQNSPLAKS
KPGSTGPEPPIPQASPGPPGPLSQTPPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQ
SLQDQPTRNLAAFPASHDPDPAIPAPTATPSARGAVIRQNSDPTSEGPGPSPNPPAWVRP
DNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSNSAWQIYLQRRAERGTPKPPG
PPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERNRVGVSSKPDSSPV
LSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYSSSSEEVESSEDDEEEG
EGGPAEGSRDTPGGRSDGDTDSVSTMVVHDVEEITGTQPPYGGGTMVVQRTPEEERNLLH
ADSNGYTNLPDVVQPSHSPTENSKGQSPPSKDGSGDYQSRGLVKAPGKSSFTMFVDLGIY
QPGGSGDSIPITALVGGEGTRLDQLQYDVRKGSVVNVNPTNTRAHSETPEIRKYKKRFNS
EILCAALWGVNLLVGTENGLMLLDRSGQGKVYGLIGRRRFQQMDVLEGLNLLITISGKRN
KLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGHYRVVKYERIKFLVIALKSSVEV
YAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAVDVDSGNSYDI
YIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAY
ICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVY
FMTLNRNCIMNW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361467
n/a
NameBDBM50361467
Synonyms:CHEMBL1938400
TypeSmall organic molecule
Emp. Form.C35H34ClN7O3S2
Mol. Mass.700.273
SMILESCC(C)(C)c1cc(NC(=O)NCc2ccccc2Sc2ccc3nnc(-c4ccccc4SCCO)n3c2)n(n1)-c1ccc(O)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: