Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHypoxia-inducible factor prolyl hydroxylase 1
LigandBDBM26106
Substrate/Competitorn/a
Meas. Tech.ChEMBL_797226
IC50 2100±n/a nM
Citation Suzuki TMiyata N Lysine demethylases inhibitors. J Med Chem 54:8236-50 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hypoxia-inducible factor prolyl hydroxylase 1
Name:Hypoxia-inducible factor prolyl hydroxylase
Synonyms:Egl nine homolog 2 | Estrogen-induced tag 6 | HIF prolyl hydroxylase | HIF-PH1 | HIF-prolyl hydroxylase 1 | HPH-3 | PHD1 | Prolyl hydroxylase domain-containing protein 1 | Prolyl hydroxylase domain-containing protein 1 (PHD1)
Type:Protein
Mol. Mass.:43657.01
Organism:Homo sapiens (Human)
Description:Q96KS0
Residue:407
Sequence:
MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAG
SGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRK
WAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALD
YIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQI
AWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDN
PHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEV
KPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26106
n/a
NameBDBM26106
Synonyms:CHEMBL90852 | N-oxalyl glycine, 1a | NOG | Oxalylglycine | [(carboxymethyl)carbamoyl]formic acid
TypeSmall organic molecule
Emp. Form.C4H5NO5
Mol. Mass.147.0862
SMILESOC(=O)CNC(=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: