Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEgl nine homolog 3
LigandBDBM50361475
Substrate/Competitorn/a
Meas. Tech.ChEMBL_797229
IC50 31000±n/a nM
Citation Suzuki TMiyata N Lysine demethylases inhibitors. J Med Chem 54:8236-50 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Egl nine homolog 3
Name:Egl nine homolog 3
Synonyms:Egl nine homolog 3 (EGLIN3) | Egl nine homolog 3 (EGLN3)
Type:Protein
Mol. Mass.:27265.54
Organism:Homo sapiens (Human)
Description:Q9H6Z9
Residue:239
Sequence:
MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQ
LAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKA
MVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEP
IFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361475
n/a
NameBDBM50361475
Synonyms:CHEMBL1938900
TypeSmall organic molecule
Emp. Form.C27H29N3O6
Mol. Mass.491.5357
SMILESON(CCCCNCc1ccc(COC(=O)Nc2cccc3ccccc23)cc1)C(=O)C=CC(O)=O |w:31.33|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: