Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHSP90 and hnRNPA2/B1
LigandBDBM50361670
Substrate/Competitorn/a
Meas. Tech.ChEMBL_798935
IC50 153±n/a nM
Citation Baruchello RSimoni DGrisolia GBarbato GMarchetti PRondanin RMangiola SGiannini GBrunetti TAlloatti DGallo GCiacci AVesci LCastorina MMilazzo FMCervoni MLGuglielmi MBBarbarino MFoderà RPisano CCabri W Novel 3,4-isoxazolediamides as potent inhibitors of chaperone heat shock protein 90. J Med Chem 54:8592-604 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HSP90 and hnRNPA2/B1
Name:HSP90 and hnRNPA2/B1
Synonyms:HSP 84 | HSP 90 | Heat Shock Protein 90 (Hsp90) | Heat shock protein HSP 90 (Hsp90) | Heat shock protein HSP 90-beta
Type:Molecular Chaperone
Mol. Mass.:83229.45
Organism:Homo sapiens (Human)
Description:n/a
Residue:724
Sequence:
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50361670
n/a
NameBDBM50361670
Synonyms:CHEMBL1940913
TypeSmall organic molecule
Emp. Form.C19H15BrClN3O5
Mol. Mass.480.697
SMILESCCNC(=O)c1noc(c1NC(=O)c1ccc(Br)cc1)-c1cc(Cl)c(O)cc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: