Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetchemokine (C-X-C motif) receptor 3
LigandBDBM50211114
Substrate/Competitorn/a
Meas. Tech.ChEMBL_799099
IC50 49±n/a nM
Citation Chen XMihalic JDeignan JGustin DJDuquette JDu XChan JFu ZJohnson MLi ARHenne KSullivan TLemon BMa JMiao STonn GCollins TMedina JC Discovery of potent and specific CXCR3 antagonists. Bioorg Med Chem Lett 22:357-62 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
chemokine (C-X-C motif) receptor 3
Name:chemokine (C-X-C motif) receptor 3
Synonyms:AAO92295.1 | C-X-C chemokine receptor type 3 | C-X-C chemokine receptor type 3 (CXCR3) | C-X-C chemokine receptor type 3 (CXCR3A) | CXCR3A
Type:Enzyme Catalytic Domain
Mol. Mass.:40665.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:368
Sequence:
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50211114
n/a
NameBDBM50211114
Synonyms:(-)-(R)-N-(1-(3-(4-ethoxyphenyl)-4-oxo-3,4-dihydropyrido[2,3-d]pyrimidin-2-yl)ethyl)-N-(pyridin-3-ylmethyl)-2-(4-(trifluoromethoxy)phenyl)acetamide | (R)-N-(1-(3-(4-ethoxyphenyl)-4-oxo-3,4-dihydropyrido[2,3-d]pyrimidin-2-yl)ethyl)-N-(pyridin-3-ylmethyl)-2-(4-(trifluoromethoxy)phenyl)acetamide | AMG-487 | CHEMBL397983
TypeSmall organic molecule
Emp. Form.C32H28F3N5O4
Mol. Mass.603.591
SMILESCCOc1ccc(cc1)-n1c(nc2ncccc2c1=O)[C@@H](C)N(Cc1cccnc1)C(=O)Cc1ccc(OC(F)(F)F)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: