Reaction Details |
| Report a problem with these data |
Target | Met repressor |
---|
Ligand | BDBM50362009 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_799628 (CHEMBL1941334) |
---|
EC50 | 1000±n/a nM |
---|
Citation | Joce, C; White, R; Stockley, PG; Warriner, S; Turnbull, WB; Nelson, A Design, synthesis and in vitro evaluation of novel bivalent S-adenosylmethionine analogues. Bioorg Med Chem Lett22:278-84 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Met repressor |
---|
Name: | Met repressor |
Synonyms: | Met regulon regulatory protein MetJ |
Type: | PROTEIN |
Mol. Mass.: | 12138.09 |
Organism: | Escherichia coli |
Description: | ChEMBL_799627 |
Residue: | 105 |
Sequence: | MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
|
|
|
BDBM50362009 |
---|
n/a |
---|
Name | BDBM50362009 |
Synonyms: | CHEMBL1939717 |
Type | Small organic molecule |
Emp. Form. | C18H29N7O4 |
Mol. Mass. | 407.4674 |
SMILES | CCCNC(=O)CCCN(C)C[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12 |r| |
Structure |
|