Reaction Details |
| Report a problem with these data |
Target | Met repressor |
---|
Ligand | BDBM28422 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_799628 (CHEMBL1941334) |
---|
EC50 | 17±n/a nM |
---|
Citation | Joce, C; White, R; Stockley, PG; Warriner, S; Turnbull, WB; Nelson, A Design, synthesis and in vitro evaluation of novel bivalent S-adenosylmethionine analogues. Bioorg Med Chem Lett22:278-84 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Met repressor |
---|
Name: | Met repressor |
Synonyms: | Met regulon regulatory protein MetJ |
Type: | PROTEIN |
Mol. Mass.: | 12138.09 |
Organism: | Escherichia coli |
Description: | ChEMBL_799627 |
Residue: | 105 |
Sequence: | MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
|
|
|
BDBM28422 |
---|
n/a |
---|
Name | BDBM28422 |
Synonyms: | (2S)-2-amino-4-({[(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl}(methyl)sulfanylium)butanoate | AdoMet | S-Adenosylmethionine | S-adenosyl-L-[carboxy-14C]methionine | [14COOH]AdoMet |
Type | radiolabeled substrate |
Emp. Form. | C15H22N6O5S |
Mol. Mass. | 398.437 |
SMILES | C[S+](CC[C@H](N)C([O-])=O)C[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12 |
Structure |
|