| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Met repressor |
|---|
| Ligand | BDBM28422 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_799627 (CHEMBL1941333) |
|---|
| Kd | 4.0±n/a nM |
|---|
| Citation |  Joce, C; White, R; Stockley, PG; Warriner, S; Turnbull, WB; Nelson, A Design, synthesis and in vitro evaluation of novel bivalent S-adenosylmethionine analogues. Bioorg Med Chem Lett22:278-84 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Met repressor |
|---|
| Name: | Met repressor |
|---|
| Synonyms: | Met regulon regulatory protein MetJ |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 12138.09 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | ChEMBL_799627 |
|---|
| Residue: | 105 |
|---|
| Sequence: | MAEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCE
AFLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY
|
|
|
|---|
| BDBM28422 |
|---|
| n/a |
|---|
| Name | BDBM28422 |
|---|
| Synonyms: | (2S)-2-amino-4-({[(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl}(methyl)sulfanylium)butanoate | AdoMet | S-Adenosylmethionine | S-adenosyl-L-[carboxy-14C]methionine | [14COOH]AdoMet |
|---|
| Type | radiolabeled substrate |
|---|
| Emp. Form. | C15H22N6O5S |
|---|
| Mol. Mass. | 398.437 |
|---|
| SMILES | C[S+](CC[C@H](N)C([O-])=O)C[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
