Reaction Details |
| Report a problem with these data |
Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Ligand | BDBM21447 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_797477 (CHEMBL1943220) |
---|
Ki | >100000±n/a nM |
---|
Citation | Zheng, CH; Yang, H; Zhang, M; Lu, SH; Shi, D; Wang, J; Chen, XH; Ren, XH; Liu, J; Lv, JG; Zhu, J; Zhou, YJ Design, synthesis, and activity evaluation of broad-spectrum small-molecule inhibitors of anti-apoptotic Bcl-2 family proteins: characteristics of broad-spectrum protein binding and its effects on anti-tumor activity. Bioorg Med Chem Lett22:39-44 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
Type: | Membrane; Single-pass membrane protein |
Mol. Mass.: | 37332.87 |
Organism: | Homo sapiens (Human) |
Description: | Q07820 |
Residue: | 350 |
Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
BDBM21447 |
---|
n/a |
---|
Name | BDBM21447 |
Synonyms: | 4-(4-{[2-(4-chlorophenyl)phenyl]methyl}piperazin-1-yl)-N-[(4-{[(2R)-4-(dimethylamino)-1-(phenylsulfanyl)butan-2-yl]amino}-3-nitrobenzene)sulfonyl]benzamide | ABT-737 | CHEMBL376408 | N-Benylpiperazine derivative, 2 | US11760752, Compound ABT-737 | US9125913, ABT-737 |
Type | Small organic molecule |
Emp. Form. | C42H45ClN6O5S2 |
Mol. Mass. | 813.427 |
SMILES | CN(C)CC[C@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCN(Cc2ccccc2-c2ccc(Cl)cc2)CC1 |r| |
Structure |
|