| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50362303 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_797688 (CHEMBL1943908) |
|---|
| IC50 | 1.3±n/a nM |
|---|
| Citation |  McCauley, JP; Dantzman, CL; King, MM; Ernst, GE; Wang, X; Brush, K; Palmer, WE; Frietze, W; Andisik, DW; Hoesch, V; Doring, K; Hulsizer, J; Bui, KH; Liu, J; Hudzik, TJ; Wesolowski, SS Multiparameter exploration of piperazine derivatives asd-opioid receptor agonists for CNS indications. Bioorg Med Chem Lett22:1169-73 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50362303 |
|---|
| n/a |
|---|
| Name | BDBM50362303 |
|---|
| Synonyms: | CHEMBL1939747 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H37N5O3S |
|---|
| Mol. Mass. | 535.701 |
|---|
| SMILES | CCOC(=O)Nc1ccc(cc1)[C@H](N1CCN(Cc2cscn2)CC1)c1ccc(cc1)C(=O)N(CC)CC |r| |
|---|
| Structure | 
|
|---|
Search and Browse
