Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50362313 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_797688 (CHEMBL1943908) |
---|
IC50 | 0.900000±n/a nM |
---|
Citation | McCauley, JP; Dantzman, CL; King, MM; Ernst, GE; Wang, X; Brush, K; Palmer, WE; Frietze, W; Andisik, DW; Hoesch, V; Doring, K; Hulsizer, J; Bui, KH; Liu, J; Hudzik, TJ; Wesolowski, SS Multiparameter exploration of piperazine derivatives asd-opioid receptor agonists for CNS indications. Bioorg Med Chem Lett22:1169-73 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50362313 |
---|
n/a |
---|
Name | BDBM50362313 |
Synonyms: | CHEMBL1939739 |
Type | Small organic molecule |
Emp. Form. | C32H35FN4O2 |
Mol. Mass. | 526.6443 |
SMILES | Fc1ccc(CN2CCN(CC2)[C@H](c2ccc(cc2)C(=O)N2CCC2)c2cccc(NC(=O)C3CC3)c2)cc1 |r| |
Structure |
|