Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50362355
Substrate/Competitorn/a
Meas. Tech.ChEMBL_797692
IC50 36.1±n/a nM
Citation Qian WChen JJHuman JAya TZhu JBiswas KPeterkin THungate RWArik LJohnson EKumar GJoseph SJona JGuo HXWu Z Discovery of dehydro-oxopiperazine acetamides as novel bradykinin B1 receptor antagonists with enhanced in vitro potency. Bioorg Med Chem Lett 22:1061-7 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50362355
n/a
NameBDBM50362355
Synonyms:CHEMBL1939766
TypeSmall organic molecule
Emp. Form.C24H27N3O5S
Mol. Mass.469.553
SMILESCOc1cccc2C(CCCc12)NC(=O)C[C@H]1N(C=CNC1=O)S(=O)(=O)c1ccc(C)cc1 |r,c:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: