Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B10 |
---|
Ligand | BDBM50362846 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_798534 (CHEMBL1942331) |
---|
IC50 | 13±n/a nM |
---|
Citation | Soda, M; Hu, D; Endo, S; Takemura, M; Li, J; Wada, R; Ifuku, S; Zhao, HT; El-Kabbani, O; Ohta, S; Yamamura, K; Toyooka, N; Hara, A; Matsunaga, T Design, synthesis and evaluation of caffeic acid phenethyl ester-based inhibitors targeting a selectivity pocket in the active site of human aldo-keto reductase 1B10. Eur J Med Chem48:321-9 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B10 |
---|
Name: | Aldo-keto reductase family 1 member B10 |
Synonyms: | AK1BA_HUMAN | AKR1B10 | AKR1B11 | ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldo-keto reductase family member 1B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP |
Type: | Protein |
Mol. Mass.: | 36024.67 |
Organism: | Homo sapiens (Human) |
Description: | O60218. 1ZUA; 4JII; 4GQ0 |
Residue: | 316 |
Sequence: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
|
|
|
BDBM50362846 |
---|
n/a |
---|
Name | BDBM50362846 |
Synonyms: | CHEMBL1940394 |
Type | Small organic molecule |
Emp. Form. | C18H18O4 |
Mol. Mass. | 298.3331 |
SMILES | COc1cc(O)ccc1\C=C\C(=O)OCCc1ccccc1 |
Structure |
|