Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B1 |
---|
Ligand | BDBM7460 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_797273 (CHEMBL1942674) |
---|
IC50 | 2200±n/a nM |
---|
Citation | Naeem, S; Hylands, P; Barlow, D Construction of an Indonesian herbal constituents database and its use in Random Forest modelling in a search for inhibitors of aldose reductase. Bioorg Med Chem20:1251-8 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B1 |
---|
Name: | Aldo-keto reductase family 1 member B1 |
Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
Type: | Protein |
Mol. Mass.: | 35855.50 |
Organism: | Homo sapiens (Human) |
Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
Residue: | 316 |
Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
BDBM7460 |
---|
n/a |
---|
Name | BDBM7460 |
Synonyms: | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US11021454, Compound Quercetin | US9180183, Quercetin | med.21724, Compound 4 |
Type | Small organic molecule |
Emp. Form. | C15H10O7 |
Mol. Mass. | 302.2357 |
SMILES | Oc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O |
Structure |
|