| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member B1 |
|---|
| Ligand | BDBM83922 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_797273 (CHEMBL1942674) |
|---|
| IC50 | 8690±n/a nM |
|---|
| Citation |  Naeem, S; Hylands, P; Barlow, D Construction of an Indonesian herbal constituents database and its use in Random Forest modelling in a search for inhibitors of aldose reductase. Bioorg Med Chem20:1251-8 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member B1 |
|---|
| Name: | Aldo-keto reductase family 1 member B1 |
|---|
| Synonyms: | AKR1B1 | ALDR1 | ALDR_HUMAN | ALR2 | AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase | Aldose reductase (AR) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35855.50 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0 |
|---|
| Residue: | 316 |
|---|
| Sequence: | MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
|
|
|
|---|
| BDBM83922 |
|---|
| n/a |
|---|
| Name | BDBM83922 |
|---|
| Synonyms: | 1,6,6-trimethyl-8,9-dihydro-7H-naphtho[1,2-g][1]benzofuran-10,11-dione | 1,6,6-trimethyl-8,9-dihydro-7H-naphtho[1,2-g]benzofuran-10,11-dione | 1,6,6-trimethyl-8,9-dihydro-7H-naphtho[1,2-g]benzofuran-10,11-quinone | MLS001048863 | SMR000387068 | acs.jmedchem.1c00409_ST.743 | cid_164676 | med.21724, Compound 173 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H18O3 |
|---|
| Mol. Mass. | 294.3444 |
|---|
| SMILES | Cc1coc-2c1C(=O)C(=O)c1c3CCCC(C)(C)c3ccc-21 |
|---|
| Structure | 
|
|---|
Search and Browse
