Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50363191
Substrate/Competitorn/a
Meas. Tech.ChEMBL_800448
IC50 7800±n/a nM
Citation Majmudar JDHodges-Loaiza HBHahne KDonelson JLSong JShrestha LHarrison MLHrycyna CAGibbs RA Amide-modified prenylcysteine based Icmt inhibitors: Structure-activity relationships, kinetic analysis and cellular characterization. Bioorg Med Chem 20:283-95 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31943.26
Organism:Homo sapiens (Human)
Description:ChEMBL_956034
Residue:284
Sequence:
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50363191
n/a
NameBDBM50363191
Synonyms:CHEMBL1946593
TypeSmall organic molecule
Emp. Form.C31H39NO4S
Mol. Mass.521.711
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#16]-[#6]-[#6@@H](-[#7]-[#6](=O)-c1ccccc1-[#8]-c1ccccc1)-[#6](-[#8])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: