Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 3 (CA III)
LigandBDBM50363542
Substrate/Competitorn/a
Meas. Tech.ChEMBL_801536
Ki 2130±n/a nM
Citation Ekinci DCavdar HDurdagi STalaz OSentürk MSupuran CT Structure-activity relationships for the interaction of 5,10-dihydroindeno[1,2-b]indole derivatives with human and bovine carbonic anhydrase isoforms I, II, III, IV and VI. Eur J Med Chem 49:68-73 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 3 (CA III)
Name:Carbonic anhydrase 3 (CA III)
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 | Carbonic anhydrase III
Type:Enzyme
Mol. Mass.:29376.92
Organism:Bos taurus (Cattle)
Description:Q3SZX4
Residue:260
Sequence:
MAKEWGYADHNGPDHWHELFPNAKGENQSPIELNTKEISHDPSLKPWTASYDPGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLAAPYRLRQFHLHWGSSDDHGSEHSVDGVKYAAELHL
VHWNSKYNSYATALKHADGIAVVGVFLKIGREKGEFQLLLDALDKIKTKGKEAPFNNFNP
SCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRTLYSSAENEPPVPL
VRNWRPPQPIKGRIVKASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50363542
n/a
NameBDBM50363542
Synonyms:CHEMBL596277
TypeSmall organic molecule
Emp. Form.C15H11NO2
Mol. Mass.237.2533
SMILESOc1ccc-2c(Cc3c-2[nH]c2ccccc32)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: