Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNitric-oxide synthase, endothelial
LigandBDBM50240895
Substrate/Competitorn/a
Meas. Tech.ChEMBL_801785
Ki>5000000±n/a nM
Citation Salerno LModica MNRomeo GPittalà VSiracusa MAAmato MEAcquaviva RDi Giacomo CSorrenti V Novel inhibitors of nitric oxide synthase with antioxidant properties. Eur J Med Chem 49:118-26 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nitric-oxide synthase, endothelial
Name:Nitric-oxide synthase, endothelial
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:132922.33
Organism:Mus musculus
Description:ChEMBL_801785
Residue:1202
Sequence:
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSQAPAPPSPTRPAPDHSPPLTR
PPDGPRFPRVKNWEVGSITYDTLSAQAQQDGPCTSRRCLGSLVFPRKLQSRPTQGPSPTE
QLLGQARDFINQYYNSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDF
RIWNSQLIRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTLPPEMVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSAAKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAESLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPSTEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEESSEQQELEALSQDPRRYE
EWKWFSCPTLLEVLEQFPSVALPAPLILTQLPLLQPRYYSVSSAPSAHPGEIHLTIAVLA
YRTQDGLGPLHYGVCSTWMSQLKAGDPVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQDRLHDIEIKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGQVLTAFSRDP
GSPKTYVQDLLRTELAAEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGGMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWSFDPPGPEIP
GS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50240895
n/a
NameBDBM50240895
Synonyms:2-(1H-Imidazol-1-yl)-1-(4-nitrophenyl)ethanone | 2-Imidazol-1-yl-1-(4-nitro-phenyl)-ethanone | CHEMBL162549
TypeSmall organic molecule
Emp. Form.C11H9N3O3
Mol. Mass.231.2075
SMILES[O-][N+](=O)c1ccc(cc1)C(=O)Cn1ccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: