| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM10877 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_801827 (CHEMBL1947439) |
|---|
| Ki | 1380±n/a nM |
|---|
| Citation |  Ohradanova, A; Vullo, D; Pastorekova, S; Pastorek, J; Jackson, DJ; Wörheide, G; Supuran, CT Cloning, characterization and sulfonamide inhibition studies of ana-carbonic anhydrase from the living fossil sponge Astrosclera willeyana. Bioorg Med Chem20:1403-10 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | Astrosclerin-3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33233.07 |
|---|
| Organism: | Astrosclera willeyana |
|---|
| Description: | ChEMBL_801827 |
|---|
| Residue: | 292 |
|---|
| Sequence: | MMAYKVLHFVVISLGLVTLVASRCDFNYYNQRAWLSCPGSQCGGNRQSPINIDTEKTKAN
NSLIALRFNDYDDPVDGDFENLGTTVEFVPETKDATLTNHLGTYDLLQFHFHWGRDSSEG
SEHRIDDEQYSAEIHFVHLKQGASPSDTAGDTFSVVAVLCEAADIPIRGVWAKLSPVPTG
HEDSHSVSDLVYTDLLPRNRDYYHYEGSLTTPLCDETVQWFVLKNTIKIPKAFLTMLRRV
ESDEDGTLLTFNFRNLQRLNGRQVFEFPPDVDNGEDKKRKRRNNRHGRDHHG
|
|
|
|---|
| BDBM10877 |
|---|
| n/a |
|---|
| Name | BDBM10877 |
|---|
| Synonyms: | 4-(2-hydroxyethyl)benzene-1-sulfonamide | CHEMBL6784 | JMC522226 Compound 21 | JMC523116 Compound 21 | aromatic/heteroaromatic sulfonamide 22 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H11NO3S |
|---|
| Mol. Mass. | 201.243 |
|---|
| SMILES | NS(=O)(=O)c1ccc(CCO)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
