Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50363928
Substrate/Competitorn/a
Meas. Tech.ChEMBL_805477
IC50 4±n/a nM
Citation Liu JLi ARWang YJohnson MGSu YShen WWang XLively SBrown MLai SGonzalez Lopez De Turiso FXu QVan Lengerich BSchmitt MFu ZSun YLawlis SSeitz LDanao JWait JYe QTang HLGrillo MCollins TLSullivan TJMedina JC Discovery of AMG 853, a CRTH2 and DP Dual Antagonist. ACS Med Chem Lett 2:326-330 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme
Mol. Mass.:40288.87
Organism:Homo sapiens (Human)
Description:Q13258
Residue:359
Sequence:
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50363928
n/a
NameBDBM50363928
Synonyms:CHEMBL1951575
TypeSmall organic molecule
Emp. Form.C28H27Cl2FN2O6S
Mol. Mass.609.493
SMILESCC(C)(C)NC(=O)c1ccc(Oc2cc(F)c(CC(O)=O)cc2Cl)c(NS(=O)(=O)c2ccc(cc2Cl)C2CC2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: