Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEndothelial lipase
LigandBDBM50364299
Substrate/Competitorn/a
Meas. Tech.ChEMBL_804415
IC50 2800±n/a nM
Citation O'Connell DPLeBlanc DFCromley DBillheimer JRader DJBachovchin WW Design and synthesis of boronic acid inhibitors of endothelial lipase. Bioorg Med Chem Lett 22:1397-401 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Endothelial lipase
Name:Endothelial lipase
Synonyms:EDL | EL | Endothelial cell-derived lipase | LIPG
Type:Protein
Mol. Mass.:56805.62
Organism:Homo sapiens (Human)
Description:Q9Y5X9
Residue:500
Sequence:
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPE
HEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVV
VDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGN
FVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHID
IYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKN
MGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWF
RKCRDGWRMKNETSPTVELP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50364299
n/a
NameBDBM50364299
Synonyms:CHEMBL1952311
TypeSmall organic molecule
Emp. Form.C16H19BO3
Mol. Mass.270.131
SMILESCC1(C)OB(OC1(C)C)c1ccc(cc1)-c1ccoc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: