| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50364832 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_803536 (CHEMBL1953284) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Hada, K; Suda, A; Asoh, K; Tsukuda, T; Hasegawa, M; Sato, Y; Ogawa, K; Kuramoto, S; Aoki, Y; Shimma, N; Ishikawa, T; Koyano, H Angiogenesis inhibitors identified by cell-based high-throughput screening: synthesis, structure-activity relationships and biological evaluation of 3-[(E)-styryl]benzamides that specifically inhibit endothelial cell proliferation. Bioorg Med Chem20:1442-60 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50364832 |
|---|
| n/a |
|---|
| Name | BDBM50364832 |
|---|
| Synonyms: | CHEMBL1949788 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20ClNO4 |
|---|
| Mol. Mass. | 361.819 |
|---|
| SMILES | COc1ccc(cc1\C=C\c1ccc(Cl)cc1)C(=O)NC[C@@H](O)CO |r| |
|---|
| Structure | 
|
|---|
Search and Browse
