Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-2 adrenergic receptor
LigandBDBM50365057
Substrate/Competitorn/a
Meas. Tech.ChEMBL_804869
EC50 0.501±n/a nM
Citation Shan WJHuang LZhou QJiang HLLuo ZHLai KFLi XS Dualß2-adrenoceptor agonists-PDE4 inhibitors for the treatment of asthma and COPD. Bioorg Med Chem Lett 22:1523-6 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-2 adrenergic receptor
Name:Beta-2 adrenergic receptor
Synonyms:adrenergic Beta2
Type:Enzyme Catalytic Domain
Mol. Mass.:46993.24
Organism:GUINEA PIG
Description:adrenergic Beta2 ADRB2 GUINEA PIG::Q8K4Z4
Residue:418
Sequence:
MGHLGNGSDFLLAPNASHAPDHNVTRERDEAWVVGMAIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGASHILMNMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVVILMVWVVSGLTSFLPIQMHWYRATHKD
AINCYAEETCCDFFTNQAYAIASSIVSFYLPLVVMVFVYSRVFQVAKKQLQKIDRSEGRF
HTQNLSQVEQDGRSGHGLRRSSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIPKEVYILLNWVGYVNSAFNPLIYCRSPDFRIAFQELLCLRRSALKAYGNDCSSNSNG
KTDYTGEPNVCHQGQEKERELLCEDPPGTEDLVSCPGTVPSDSIDSQGRNYSTNDSLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365057
n/a
NameBDBM50365057
Synonyms:CHEMBL1951066
TypeSmall organic molecule
Emp. Form.C29H38N4O6
Mol. Mass.538.6352
SMILESCOc1ccc(cc1OC)C1=NN(CCCCNCC(O)c2ccc(O)c(NC=O)c2)C(=O)C2CCCCC12 |t:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: