Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEukaryotic translation initiation factor 4E
LigandBDBM50365103
Substrate/Competitorn/a
Meas. Tech.ChEMBL_804894
IC50 5000±n/a nM
Citation Rydzik AMKulis MLukaszewicz MKowalska JZuberek JDarzynkiewicz ZMDarzynkiewicz EJemielity J Synthesis and properties of mRNA cap analogs containing imidodiphosphate moiety--fairly mimicking natural cap structure, yet resistant to enzymatic hydrolysis. Bioorg Med Chem 20:1699-710 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Eukaryotic translation initiation factor 4E
Name:Eukaryotic translation initiation factor 4E
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:25047.40
Organism:Oryctolagus cuniculus
Description:ChEMBL_1511842
Residue:217
Sequence:
MATVEPETTPTPNPPPAEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365103
n/a
NameBDBM50365103
Synonyms:CHEMBL1951189
TypeSmall organic molecule
Emp. Form.C21H26N10O21P4
Mol. Mass.878.3828
SMILESC[n+]1cn([C@@H]2O[C@H](COP([O-])(=O)OP([O-])(=O)OP([O-])(=O)OP([O-])(=O)OC[C@H]3O[C@H]([C@H](O)[C@@H]3O)n3cnc4c3nc(N)[nH]c4=O)[C@@H](O)[C@H]2O)c2nc(N)[n-]c(=O)c12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: