Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-activated protein kinase 2
LigandBDBM32362
Substrate/Competitorn/a
Meas. Tech.ChEMBL_806409
IC50>10000±n/a nM
Citation Conway JGMcDonald BParham JKeith BRusnak DWShaw EJansen MLin PPayne ACrosby RMJohnson JHFrick LLin MHDepee STadepalli SVotta BJames IFuller KChambers TJKull FCChamberlain SDHutchins JT Inhibition of colony-stimulating-factor-1 signaling in vivo with the orally bioavailable cFMS kinase inhibitor GW2580. Proc Natl Acad Sci U S A 102:16078-83 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-activated protein kinase 2
Name:MAP kinase-activated protein kinase 2
Synonyms:MAP kinase-activated protein kinase 2 (MAPKAPK2) | MAP kinase-activated protein kinase 2 (MK2) | MAP kinase-activated protein kinase 2 (p38/MK2) | MAPK-Activated Protein Kinase 2 (MK2) | MAPK-activated protein kinase 2 | MAPKAP kinase 2 | MAPKAPK-2 | MAPKAPK2 | MK2
Type:Serine/threonine-protein kinase
Mol. Mass.:45579.87
Organism:Homo sapiens (Human)
Description:P49137
Residue:400
Sequence:
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32362
n/a
NameBDBM32362
Synonyms:5-[[3-methoxy-4-[(4-methoxyphenyl)methoxy]phenyl]methyl]pyrimidine-2,4-diamine | GW-2580 | [2-amino-5-(3-methoxy-4-p-anisyloxy-benzyl)pyrimidin-4-yl]amine | cid_11617559
TypeSmall organic molecule
Emp. Form.C20H22N4O3
Mol. Mass.366.4137
SMILESCOc1ccc(COc2ccc(Cc3cnc(N)nc3N)cc2OC)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: