Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-25
LigandBDBM50365344
Substrate/Competitorn/a
Meas. Tech.ChEMBL_806652
Ki>10000±n/a nM
Citation Brown MFReilly UAbramite JAArcari JTOliver RBarham RAChe YChen JMCollantes EMChung SWDesbonnet CDoty JDoroski MEngtrakul JJHarris TMHuband MKnafels JDLeach KLLiu SMarfat AMarra AMcElroy EMelnick MMenard CAMontgomery JIMullins LNoe MCO'Donnell JPenzien JPlummer MSPrice LMShanmugasundaram VThoma CUccello DPWarmus JSWishka DG Potent inhibitors of LpxC for the treatment of Gram-negative infections. J Med Chem 55:914-23 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-25
Name:Matrix metalloproteinase-25
Synonyms:Leukolysin | MMP-25 | MT-MMP 6 | MT6-MMP | MT6MMP | MTMMP6 | Matrix metalloproteinase-25 | Membrane-type matrix metalloproteinase 6 | Membrane-type-6 matrix metalloproteinase | Membrane-type-6 matrix metalloproteinase (MT6-MMP)
Type:Protein
Mol. Mass.:62564.84
Organism:Homo sapiens (Human)
Description:Q9NPA2
Residue:562
Sequence:
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365344
n/a
NameBDBM50365344
Synonyms:CHEMBL1956115
TypeSmall organic molecule
Emp. Form.C18H21NO4S
Mol. Mass.347.429
SMILESC[C@@](CCc1ccc(cc1)-c1ccccc1)(C(=O)NO)S(C)(=O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: