Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetActivator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
LigandBDBM50365705
Substrate/Competitorn/a
Meas. Tech.ChEMBL_808456
EC50 1780±n/a nM
Citation Woods KWLai CMiyashiro JMTong YFlorjancic ASHan EKSoni NShi YLasko LLeverson JDJohnson EFShoemaker ARPenning TD Aminopyrimidinone cdc7 kinase inhibitors. Bioorg Med Chem Lett 22:1940-3 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Activator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
Name:Activator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
Synonyms:CDC7/DBF4 (Cell division cycle 7-related protein kinase/Activator of S phase kinase)
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 747259
Components:This complex has 2 components.
Component 1
Name:Cell division cycle 7-related protein kinase
Synonyms:Cell division cycle 7-related protein kinase | Cell division cycle 7-related protein kinase (CDC7)
Type:Protein
Mol. Mass.:63908.16
Organism:Homo sapiens (Human)
Description:O00311
Residue:574
Sequence:
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:DBF4
Synonyms:Activator of S phase kinase | Chiffon homolog A | DBF4-type zinc finger-containing protein 1 | DBF4A | Protein DBF4 homolog A
Type:Regulatory subunit
Mol. Mass.:76869.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:674
Sequence:
MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
AFFSSPSTSTFTGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50365705
n/a
NameBDBM50365705
Synonyms:CHEMBL1958419
TypeSmall organic molecule
Emp. Form.C16H17N5O2
Mol. Mass.311.3385
SMILESOC1CCN(CC1)c1nc(cc(=O)[nH]1)-c1c[nH]c2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: