Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAromatase (CYP19)
LigandBDBM13061
Substrate/Competitorn/a
Meas. Tech.ChEMBL_808290
IC50 2±n/a nM
Citation Mayhoub ASMarler LKondratyuk TPPark EJPezzuto JMCushman M Optimization of the aromatase inhibitory activities of pyridylthiazole analogues of resveratrol. Bioorg Med Chem 20:2427-34 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aromatase (CYP19)
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Cytochrome P-450AROM | Cytochrome P450 19A1 | Cytochrome P450 2C19 | Cytochrome P450-C19 (CYP19) | Estrogen synthetase | FL cytokine receptor precursor | P-450AROM | Tyrosine Kinase FLT3
Type:Enzyme
Mol. Mass.:57888.92
Organism:Homo sapiens (Human)
Description:P11511
Residue:503
Sequence:
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13061
n/a
NameBDBM13061
Synonyms:4,4 -(1H-1,2,4-triazol-1-ylmethanediyl)dibenzonitrile | 4-[(4-cyanophenyl)(1H-1,2,4-triazol-1-yl)methyl]benzonitrile | CHEMBL1444 | Letrozole
TypeSmall organic molecule
Emp. Form.C17H11N5
Mol. Mass.285.3027
SMILESN#Cc1ccc(cc1)C(c1ccc(cc1)C#N)n1cncn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: