Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid EP3 Receptor
LigandBDBM35847
Substrate/Competitorn/a
Meas. Tech.ChEMBL_808315
Ki 5±n/a nM
Citation Kambe TMaruyama TNakai YYoshida HOida HMaruyama TAbe NNishiura ANakai HToda M Discovery of novel prostaglandin analogs as potent and selective EP2/EP4 dual agonists. Bioorg Med Chem 20:2235-51 (2012) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid EP3 Receptor
Name:Prostanoid EP3 receptor
Synonyms:PGE receptor, EP3 isoform alpha | PTGER3 | Prostaglandin E2 receptor EP3 isoform alpha | Prostaglandin E3
Type:G-protein coupled receptor
Mol. Mass.:40092.50
Organism:Mus musculus (Mouse)
Description:n/a
Residue:365
Sequence:
MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP
GTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA
AVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE
CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMWS
DQLER
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35847
n/a
NameBDBM35847
Synonyms:(15S)-prostaglandin E2 | (5Z,11alpha,13E,15S)-11,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (5Z,13E,15S)-11alpha,15-dihydroxy-9-oxoprosta-5,13-dien-1-oic acid | (E,Z)-(1R,2R,3R)-7-(3-Hydroxy-2-((3S)-(3-hydroxy-1-octenyl))-5-oxocyclopentyl)-5-heptenoic acid | CHEMBL548 | DINOPROSTONE | PGE2 | [3H]Dinoprostone | [3H]PGE2 | [3H]Prostaglandin E2 | prostaglandin E2
Typeradiolabeled ligand
Emp. Form.C20H32O5
Mol. Mass.352.4651
SMILESCCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: