Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine receptor
LigandBDBM50007568
Substrate/Competitorn/a
Meas. Tech.ChEBML_62769
Ki 0.400000±n/a nM
Citation Campiani GButini SFattorusso CCatalanotti BGemma SNacci VMorelli ECagnotto AMereghetti IMennini TCarli MMinetti PDi Cesare MAMastroianni DScafetta NGalletti BStasi MACastorina MPacifici LVertechy MDi Serio SGhirardi OTinti OCarminati P Pyrrolo[1,3]benzothiazepine-based serotonin and dopamine receptor antagonists. Molecular modeling, further structure-activity relationship studies, and identification of novel atypical antipsychotic agents. J Med Chem 47:143-57 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dopamine receptor
Name:Dopamine receptor D2 and D3
Synonyms:D(3) dopamine receptor | DOPAMINE D3 | DRD3 | Dopamine D3 receptor
Type:Protein
Mol. Mass.:49540.58
Organism:Rattus norvegicus (Rat)
Description:P19020
Residue:446
Sequence:
MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL
QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN
LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI
CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ
QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK
RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP
LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV
NSALNPVIYTTFNVEFRKAFLKILSC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007568
n/a
NameBDBM50007568
Synonyms:1-((S)-8-Chloro-10,11-dihydro-dibenzo[b,f]thiepin-10-yl)-4-methyl-piperazine | 1-(8-Chloro-10,11-dihydro-dibenzo[b,f]thiepin-10-yl)-4-methyl-piperazine | CHEMBL303313 | OCTOCLOTHEPIN-S
TypeSmall organic molecule
Emp. Form.C19H21ClN2S
Mol. Mass.344.901
SMILESCN1CCN(CC1)[C@H]1Cc2ccccc2Sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: