BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50002823
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155142
Ki 6.1±n/a nM
Citation Sahoo SPGraham DWActon JBiftu TBugianesi RLGirotra NNKuo CPonpipom MMDoebber TWWu MSHwang SLam MMacIntyre DBach TJLuell SMeurer RDavies PAlberts AWChabala JC Synthesis and biological activity of MK 287 (L-680,573): a potent, specific and orally active paf receptor antagonist Bioorg Med Chem Lett 1:327-332 (1991)    Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50002823
n/a
NameBDBM50002823
Synonyms:2-{3-Methoxy-2-propoxy-5-[(2S,5S)-5-(3,4,5-trimethoxy-phenyl)-tetrahydro-furan-2-yl]-benzenesulfonyl}-ethanol | CHEMBL299944 | L-680573 | MK-287
TypeSmall organic molecule
Emp. Form.C25H34O9S
Mol. Mass.510.597
SMILESCCCOc1c(OC)cc(cc1S(=O)(=O)CCO)[C@@H]1CC[C@H](O1)c1cc(OC)c(OC)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: