| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM81972 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_155143 (CHEMBL760184) |
|---|
| Ki | 14.3±n/a nM |
|---|
| Citation |  Bugianesi, RL; Ponpipom, MM; Parsons, WH; Hwang, S; Doebber, TW; Lam, M; Wu, MS; Alberts, AW; Chabala, JC Synthesis and biological activity of the platelet-activating factor antagonist ()-trans-2-(3-methoxy-4-phenylsulfonylethoxy-5-n-propylsulfonylphenyl)-5-(3,4,5-trimethoxyphenyl)tetrahydrofuran (L-671,284) and its analogs Bioorg Med Chem Lett2:181-184 (1992) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF Platelet activating factor | PAF-R | PAFR | PTAFR | PTAFR_HUMAN | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39219.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PAF Platelet activating factor PTAFR HUMAN::P25105 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
|
|
|
|---|
| BDBM81972 |
|---|
| n/a |
|---|
| Name | BDBM81972 |
|---|
| Synonyms: | (S)-(+)-ALPHA-METHYL-1H-IMIDAZOLE-4-ETHANAMINE DIHYDROBROMIDE | Alpha-Methylhistamine-S | CAS_75614-93-6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C6H11N3 |
|---|
| Mol. Mass. | 125.1716 |
|---|
| SMILES | C[C@H](N)Cc1cnc[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
