| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2, major isoenzyme |
|---|
| Ligand | BDBM50015214 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_156338 |
|---|
| IC50 | 100000±n/a nM |
|---|
| Citation |  Wilkerson, WW; Galbraith, W; DeLucca, I; Harris, RR Topical antiinflammatory dehydroabietylamine derivatives. IV Bioorg Med Chem Lett3:2087-2092 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2, major isoenzyme |
|---|
| Name: | Phospholipase A2, major isoenzyme |
|---|
| Synonyms: | Group IB phospholipase A2 | PA21B_PIG | PLA2G1B | Phosphatidylcholine 2-acylhydrolase | Phospholipase A2 |
|---|
| Type: | Hydrolase; monomer or homodimer |
|---|
| Mol. Mass.: | 16279.83 |
|---|
| Organism: | Sus scrofa (pig) |
|---|
| Description: | Purchased from Sigma. |
|---|
| Residue: | 146 |
|---|
| Sequence: | MKFLVLAVLLTVGAAQEGISSRALWQFRSMIKCAIPGSHPLMDFNNYGCYCGLGGSGTPV
DELDRCCETHDNCYRDAKNLDSCKFLVDNPYTESYSYSCSNTEITCNSKNNACEAFICNC
DRNAAICFSKAPYNKEHKNLDTKKYC
|
|
|
|---|
| BDBM50015214 |
|---|
| n/a |
|---|
| Name | BDBM50015214 |
|---|
| Synonyms: | 6-chloro-2-methoxy-9-acridinyl(4-diethylamino-1-methylbutyl)amine | 6-chloro-N-(5-(diethylamino)pentan-2-yl)-2-methoxyacridin-9-amine | CHEMBL7568 | N'-(6-chloro-2-methoxy-acridin-9-yl)-N,N-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine (Mepacrine) | N*4*-(6-Chloro-2-methoxy-acridin-9-yl)-N*1*,N*1*-diethyl-pentane-1,4-diamine ; (mepacrine) | N-(4-Hydroxy-phenyl)-acetamide | cid_237 | quinacrine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H30ClN3O |
|---|
| Mol. Mass. | 399.957 |
|---|
| SMILES | CCN(CC)CCCC(C)Nc1c2ccc(Cl)cc2nc2ccc(OC)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
