Reaction Details |
| Report a problem with these data |
Target | Phospholipase A2 |
---|
Ligand | BDBM50281623 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_156506 |
---|
IC50 | 2400±n/a nM |
---|
Citation | Wilkerson, W; DeLucca, I; Galbraith, W; Harris, R; Kerr, J Antiinflammatory -benzeneethanamines. III Bioorg Med Chem Lett3:711-716 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Phospholipase A2 |
---|
Name: | Phospholipase A2 |
Synonyms: | PA21B_RAT | Phospholipase A2 group 1B | Pla2g1b |
Type: | PROTEIN |
Mol. Mass.: | 16427.59 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_156506 |
Residue: | 146 |
Sequence: | MKLLLLAALLTAGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPV
DDLDRCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNC
DRQAAICFSKVPYNKEYKDLDTKKHC
|
|
|
BDBM50281623 |
---|
n/a |
---|
Name | BDBM50281623 |
Synonyms: | 2-(4-fluorophenyl)-6-(2-naphthylsulfanyl)-1-hexanamine; with Hydrochloric acid | CHEMBL542998 |
Type | Small organic molecule |
Emp. Form. | C22H24FNS |
Mol. Mass. | 353.496 |
SMILES | NCC(CCCCSc1ccc2ccccc2c1)c1ccc(F)cc1 |
Structure |
|