| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Phospholipase A2 |
|---|
| Ligand | BDBM50281626 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_156506 |
|---|
| IC50 | 14000±n/a nM |
|---|
| Citation |  Wilkerson, W; DeLucca, I; Galbraith, W; Harris, R; Kerr, J Antiinflammatory -benzeneethanamines. III Bioorg Med Chem Lett3:711-716 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Phospholipase A2 |
|---|
| Name: | Phospholipase A2 |
|---|
| Synonyms: | PA21B_RAT | Phospholipase A2 group 1B | Pla2g1b |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16427.59 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_156506 |
|---|
| Residue: | 146 |
|---|
| Sequence: | MKLLLLAALLTAGVTAHSISTRAVWQFRNMIKCTIPGSDPLREYNNYGCYCGLGGSGTPV
DDLDRCCQTHDHCYNQAKKLESCKFLIDNPYTNTYSYKCSGNVITCSDKNNDCESFICNC
DRQAAICFSKVPYNKEYKDLDTKKHC
|
|
|
|---|
| BDBM50281626 |
|---|
| n/a |
|---|
| Name | BDBM50281626 |
|---|
| Synonyms: | 2-(4-fluorophenyl)-5-(2-naphthylsulfanyl)-1-pentanamine; with Hydrochloric acid | CHEMBL535346 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H22FNS |
|---|
| Mol. Mass. | 339.469 |
|---|
| SMILES | NCC(CCCSc1ccc2ccccc2c1)c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
