| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Type-1 angiotensin II receptor B |
|---|
| Ligand | BDBM50282244 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_34833 (CHEMBL648767) |
|---|
| Ki | 3600±n/a nM |
|---|
| Citation |  Poss, MA; Gu, Z; Ryono, DE; Reid, JA; Sieber-McMaster, E; Spitzmiller, ER; Dejneka, T; Dickinson, KE; Williams, SB; Moreland, S; Delaney, CL; Bird, J; Waldron, TL; Schaeffer, TR; Hedberg, S; Petrillo, EW 1,4-substituted indoles: a potent and selective class of angiostensin II receptor antagonists Bioorg Med Chem Lett4:145-150 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Type-1 angiotensin II receptor B |
|---|
| Name: | Type-1 angiotensin II receptor B |
|---|
| Synonyms: | AGTRB_RAT | AT3 | Agtr1 | Agtr1b | Angiotensin II AT1B | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | At1b | Type-1B angiotensin II receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40929.44 |
|---|
| Organism: | RAT |
|---|
| Description: | Angiotensin II AT1B 0 RAT::P29089 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
|
|
|
|---|
| BDBM50282244 |
|---|
| n/a |
|---|
| Name | BDBM50282244 |
|---|
| Synonyms: | 2-Butyl-3-{1-[2-(2H-tetrazol-5-yl)-phenyl]-1H-indol-4-ylmethyl}-3H-imidazole-4-carboxylic acid | CHEMBL433230 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23N7O2 |
|---|
| Mol. Mass. | 441.4851 |
|---|
| SMILES | CCCCc1ncc(C(O)=O)n1Cc1cccc2n(ccc12)-c1ccccc1-c1nnn[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
