new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeprilysin
LigandBDBM50283642
Substrate/Competitorn/a
Meas. Tech.ChEBML_144632
IC50 2±n/a nM
Citation De Lombaert STan JStamford LJSakane YBerry CGhai RD Dual inhibition of neutral endopeptidase and angiotensin-converting enzyme by N-phosphonomethyl and N-carboxyalkyl dipeptides Bioorg Med Chem Lett 4:2715-2720 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Neprilysin
Name:Neprilysin
Synonyms:Atriopeptidase | CALLA | CD_antigen=CD10 | Common acute lymphocytic leukemia antigen | Enkephalinase | NEP | Neutral Endopeptidase (NEP) | Neutral endopeptidase | Neutral endopeptidase 24.11
Type:Enzyme
Mol. Mass.:85505.38
Organism:Homo sapiens (Human)
Description:P08473
Residue:750
Sequence:
MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSS
DCIKSAARLIQNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKD
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGA
SWTAEKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRLGLPSRDYYECTGIYKE
ACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELEKEIANATAKPEDRNDPMLLY
NKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPEYLTKLKPILT
KYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERI
GYPDDIVSNDNKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAA
VVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKD
GDLVDWWTQQSASNFKEQSQCMVYQYGNFSWDLAGGQHLNGINTLGENIADNGGLGQAYR
AYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRPEYAVNSIKTDVHSPGNFRII
GTLQNSAEFSEAFHCRKNSYMNPEKKCRVW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283642
n/a
NameBDBM50283642
Synonyms:(S)-3-Biphenyl-4-yl-2-{(S)-3-methyl-2-[((R)-phosphonomethyl)-amino]-pentanoylamino}-propionic acid | CHEMBL90545
TypeSmall organic molecule
Emp. Form.C22H29N2O6P
Mol. Mass.448.4492
SMILESCC[C@@H](C)[C@H](NCP(O)(O)=O)C(=O)N[C@@H](Cc1ccc(cc1)-c1ccccc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: